Lengthy

Unofficially, the world’s longest place name:

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit.

Pronounce THAT! It’s actually an unofficial record because the actual official english name for that city is…BANGKOK! (you know, in Thailand)… The other 2 contenters are:

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

Which is in Welsh and actually means “Saint Mary’s Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave.” It also has the longest single-word domain in the world at: http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/. Don’t bother trying to beat that record, it is an exception: normal domain registration does not allow domains longer than 28 characters. And finally, from New Zealand, the longest place name as recognized by the Guiness book of World Records:

Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronuku pokaiwhenuaakitanarahu

It means “The place where Tamatea, the man with the big knees, who slid, climbed, and swallowed mountains, known as land eater, played his flute to his loved one.” O.o All taken from http://www.thailandlife.com/ericshackle/placename.html